4.67 Rating by ClearWebStats
theshoppievilla.com is 3 years 8 months 3 weeks old. This website has a #3,543,084 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, theshoppievilla.com is SAFE to browse.
Get Custom Widget

Traffic Report of Theshoppievilla

Daily Unique Visitors: 136
Daily Pageviews: 272

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 3,543,084
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View theshoppievilla.com site advisor rating Not Applicable

Where is theshoppievilla.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with theshoppievilla.com

Hosted Country:

theshoppievilla.com hosted country US theshoppievilla.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View theshoppievilla.com HTML resources

Homepage Links Analysis

THE SHOPPIE VILLA

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 21
H3 Headings: 9 H4 Headings: 5
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 48
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

theshoppievilla.com favicon - jenniferchemsales.com

View theshoppievilla.com Pagerank   theshoppievilla.com alexa rank Not Applicable   theshoppievilla.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

theshoppievilla.com favicon - shrivishwakarmasafetytraininginstitute.com

View theshoppievilla.com Pagerank   theshoppievilla.com alexa rank Not Applicable   theshoppievilla.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

theshoppievilla.com favicon - theshineenglishacademy.com

View theshoppievilla.com Pagerank   theshoppievilla.com alexa rank Not Applicable   theshoppievilla.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

theshoppievilla.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View theshoppievilla.com Pagerank   theshoppievilla.com alexa rank Not Applicable   theshoppievilla.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

theshoppievilla.com favicon - 247bestpillpharma.com

View theshoppievilla.com Pagerank   theshoppievilla.com alexa rank Not Applicable   theshoppievilla.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 01 Sep 2020 11:14:32 GMT
Server: Apache
Link: <https://theshoppievilla.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://theshoppievilla.com/index.php?rest_route=/wp/v2/pages/235>; rel="alternate"; type="application/json", <https://theshoppievilla.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for theshoppievilla.com

Domain Registrar: GODADDY.COM, LLC theshoppievilla.com registrar info
Registration Date: 2020-08-22 3 years 8 months 3 weeks ago
Last Modified: 2020-08-24 3 years 8 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net theshoppievilla.com name server information 162.241.148.33 theshoppievilla.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net theshoppievilla.com name server information 162.241.148.33 theshoppievilla.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
theshoppievilla.com A 14400 IP:162.241.148.33
theshoppievilla.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
theshoppievilla.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
theshoppievilla.com SOA 86400 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:sampurnraj100.gmail.com
Serial:2020082402
Refresh:86400
Retry:7200
Expire:3600000
theshoppievilla.com MX 14400 Target:mail.theshoppievilla.com
theshoppievilla.com TXT 14400 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Theshoppievilla

CWT Savvy Traveler

theshoppievilla.com favicon - cwtsavvytraveler.com

The CWT Savvy Traveler blog offers travel tips, business travel best practices, safety and security advice, destination information and vacation tips.

View theshoppievilla.com Pagerank   Alexa rank for theshoppievilla.com 3,543,090   website value of theshoppievilla.com $ 240.00


Birthday Anniversary gifts wedding decorations for Mum Dad kids sisters friends

theshoppievilla.com favicon - easygift.com.au

Buy your Fathers Day gift, wedding table decorations, christmas fairy lights, family photo albums and lots of other inexpensive gift for birthday and anniversaries. Plus great kids fairy lights

View theshoppievilla.com Pagerank   Alexa rank for theshoppievilla.com 3,543,116   website value of theshoppievilla.com $ 240.00

Payday Loan Leads | Payday Loan Affiliate Program | Round Sky

theshoppievilla.com favicon - leadhorizon.com

Buy payday loan leads online from the premiere payday loan affiliate program at Round Sky. We process over 20,000 real-time payday loan leads every day.

View theshoppievilla.com Pagerank   Alexa rank for theshoppievilla.com 3,543,116   website value of theshoppievilla.com $ 240.00

Luxury holiday rentals and villas to rent direct

theshoppievilla.com favicon - dreamvillarentals.com

A stunning collection of private holiday villas and luxury homes to rent in beautiful locations worldwide by Dream Villa Rentals

View theshoppievilla.com Pagerank   Alexa rank for theshoppievilla.com 3,543,116   website value of theshoppievilla.com $ 240.00

Full WHOIS Lookup for theshoppievilla.com

Domain Name: THESHOPPIEVILLA.COM
Registry Domain ID: 2554797946_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-08-24T15:18:04Z
Creation Date: 2020-08-22T10:10:02Z
Registry Expiry Date: 2021-08-22T10:10:02Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-09-01T11:14:25Z